PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof011280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 240aa    MW: 26361.5 Da    PI: 9.991
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-1080133725PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-1457101347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++d+ + lG+g+W+ I++ + ++Rt+ q+ s+ qky
        Sof011280  57 PWTEEEHRKFLDGLRNLGKGDWRGISKGFVTTRTATQVASHAQKY 101
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.20250106IPR017930Myb domain
SuperFamilySSF466892.02E-1751107IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-1753105IPR006447Myb domain, plants
SMARTSM007172.6E-954104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1055100IPR009057Homeodomain-like
PfamPF002497.6E-1257101IPR001005SANT/Myb domain
CDDcd001671.71E-957102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
XDIKKSSSMP NLIIHKPLLS PGDAGDGKGY ASDDAELASG QQKRRRRKAQ ERKKGIPWTE  60
EEHRKFLDGL RNLGKGDWRG ISKGFVTTRT ATQVASHAQK YFLRQTNLGK KKRRASLFDV  120
GIADYNYHDD QVPSPQRSIA TKPAPTQEII HTDRGDVPYR GFGEILGNNM QVNQLTDYYY  180
FKKDPNVHLE TSLSMASGLE TASSANSLDL SIIAVNSLEL SIAPPARCGC GGSAGAIKVL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14247KRRRRK
24253KRRRRKAQERKK
34353RRRRKAQERKK
4109113KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.33681e-113inflorescence| leaf| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467479.11e-156hypothetical protein SORBIDRAFT_01g028870
TrEMBLC5WRH91e-156C5WRH9_SORBI; Putative uncharacterized protein Sb01g028870
STRINGSb01g028870.11e-155(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-34MYB_related family protein